Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HAPLN1 protein

This Human HAPLN1 protein spans the amino acid sequence from region 16-354aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cartilage-linking protein 1 Short name, Cartilage-link protein Proteoglycan link protein CRTL1

UniProt

P10915

Expression Region

16-354aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

p21 Rabbit mAb
MBS8603182-01 0.1 mL

p21 Rabbit mAb

Sign In for Pricing
View Details
p21 Rabbit mAb
MBS8603182-02 0.1 mL (AF405L)

p21 Rabbit mAb

Sign In for Pricing
View Details
p21 Rabbit mAb
MBS8603182-03 0.1 mL (AF405S)

p21 Rabbit mAb

Sign In for Pricing
View Details
p21 Rabbit mAb
MBS8603182-04 0.1 mL (AF610)

p21 Rabbit mAb

Sign In for Pricing
View Details
p21 Rabbit mAb
MBS8603182-05 0.1 mL (AF635)

p21 Rabbit mAb

Sign In for Pricing
View Details
p21 Rabbit mAb
MBS8603182-06 0.1 mL (APC)

p21 Rabbit mAb

Sign In for Pricing
View Details