Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi ret protein

This Fungi ret protein spans the amino acid sequence from region 28-176aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Restrictocin

UniProt

P67876

Expression Region

28-176aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Aspergillus restrictus

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF640R conjugate, 0.1mg/mL
BNC400634-500 1x 500 µL

CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Cecum
CS630775 5x 5 µm

Frozen Tissue Sections, Cecum

Sign In for Pricing
View Details
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), CF405S conjugate, 0.1mg/mL
BNC042363-500 1x 500 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GRB7 (Center) Rabbit Polyclonal Antibody
AP51945PU-N 400 µL

GRB7 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EMA (MUC1) Mouse Monoclonal Antibody [Clone ID: E29]
AM10082PU-S 100 µg

EMA (MUC1) Mouse Monoclonal Antibody [Clone ID: E29]

Sign In for Pricing
View Details
Human KDM5A activation kit by CRISPRa
GA104037 1 Kit

Human KDM5A activation kit by CRISPRa

Sign In for Pricing
View Details