Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Abrus precatorius Abrin-a protein

This Plant Abrus precatorius Abrin-a protein spans the amino acid sequence from region 1-251aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RRNA N-glycosidase

UniProt

P11140

Expression Region

1-251aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Abrus precatorius (Indian licorice) (Glycine abrus)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDRPIKFSTEGATSQSYKQFIEALRERLRGGLIHDIPVLPDPTTLQERNRYITVELSNSDTESIEVGIDVTNAYVVAYRAGTQSYFLRDAPSSASDYLFTGTDQHSLPFYGTYGDLERWAHQSRQQIPLGLQALTHGISFFRSGGNDNEEKARTLIVIIQMVAEAARFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFVCNPPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Heat Shock Protein 27
32-5327-50 50 µg

Recombinant Human Heat Shock Protein 27

Sign In for Pricing
View Details
KRTAP19-6 Human Over-expression Lysate
orb1354558 100 µg

KRTAP19-6 Human Over-expression Lysate

Sign In for Pricing
View Details
Timosaponin AIII
sc-364636 5 mg

Timosaponin AIII

Sign In for Pricing
View Details
PSMC1 Conjugated Antibody
MBS9447163-01 0.1 mL (Biotin)

PSMC1 Conjugated Antibody

Sign In for Pricing
View Details
PSMC1 Conjugated Antibody
MBS9447163-02 0.1 mL (AF350)

PSMC1 Conjugated Antibody

Sign In for Pricing
View Details
PSMC1 Conjugated Antibody
MBS9447163-03 0.1 mL (AF405)

PSMC1 Conjugated Antibody

Sign In for Pricing
View Details