Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RGMA protein

This Human RGMA protein spans the amino acid sequence from region 169-424aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RGM domain family member A RGM

UniProt

Q96B86

Expression Region

169-424aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYDRTRDLPGRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CXCL10/IP10 ELISA Kit
E048109 1 Each

Mouse CXCL10/IP10 ELISA Kit

Sign In for Pricing
View Details
Hsa-miR-1305 antagomir
HY-RI00236A-01 5 nmol

Hsa-miR-1305 antagomir

Sign In for Pricing
View Details
Hsa-miR-1305 antagomir
HY-RI00236A-02 20 nmol

Hsa-miR-1305 antagomir

Sign In for Pricing
View Details
RGS8 (NM_033345) Human Over-expression Lysate
LS085397-20ug 20 µg

RGS8 (NM_033345) Human Over-expression Lysate

Sign In for Pricing
View Details
Research Grade Anti-Human CXCL12/SDF-1 Antibody (Genentech anti-CXCL12)
DHE55401 100 μg

Research Grade Anti-Human CXCL12/SDF-1 Antibody (Genentech anti-CXCL12)

Sign In for Pricing
View Details
Human GABBR2 Knockout A549 cell line
GTR15419939 1 Vial

Human GABBR2 Knockout A549 cell line

Sign In for Pricing
View Details