Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NOX4 protein

This Human NOX4 protein spans the amino acid sequence from region 210-424aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Kidney oxidase-1 Short name, KOX-1 Kidney superoxide-producing NADPH oxidase Renal NAD (P) H-oxidase RENOX

UniProt

Q9NPH5

Expression Region

210-424aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GGLLKYQTNLDTHPPGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVMSHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-5582-3p Primers
MPH03271 150 µL / 10 µM

hsa-miR-5582-3p Primers

Sign In for Pricing
View Details
Arachidonate 5-Lipoxygenase-activating protein (ALOX-5AP) Horse ELISA Kit
B6523 96 Tests

Arachidonate 5-Lipoxygenase-activating protein (ALOX-5AP) Horse ELISA Kit

Sign In for Pricing
View Details
2-Amino-3-chloro-1,4-naphthoquinone
sc-470529 25 g

2-Amino-3-chloro-1,4-naphthoquinone

Sign In for Pricing
View Details
Hamster Zinc Finger Protein 36, C3H1 Type-Like 1 (ZFP36L1) ELISA Kit
MBS9912726-01 48 Well

Hamster Zinc Finger Protein 36, C3H1 Type-Like 1 (ZFP36L1) ELISA Kit

Sign In for Pricing
View Details
Hamster Zinc Finger Protein 36, C3H1 Type-Like 1 (ZFP36L1) ELISA Kit
MBS9912726-02 96 Well

Hamster Zinc Finger Protein 36, C3H1 Type-Like 1 (ZFP36L1) ELISA Kit

Sign In for Pricing
View Details
Hamster Zinc Finger Protein 36, C3H1 Type-Like 1 (ZFP36L1) ELISA Kit
MBS9912726-03 5x 96 Well

Hamster Zinc Finger Protein 36, C3H1 Type-Like 1 (ZFP36L1) ELISA Kit

Sign In for Pricing
View Details