Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria BB3856 protein

This Bacteria BB3856 protein spans the amino acid sequence from region 22-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BB3856Azurin

UniProt

P0A321

Expression Region

22-150aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AECSVDIAGTDQMQFDKKAIEVSKSCKQFTVNLKHTGKLPRNVMGHNWVLTKTADMQAVEKDGIAAGLDNQYLKAGDTRVLAHTKVLGGGESDSVTFDVAKLAAGDDYTFFCSFPGHGALMKGTLKLVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR17 Mouse Monoclonal Antibody [Clone ID: LBI17C1]
AMM20351V 100 µL

GPR17 Mouse Monoclonal Antibody [Clone ID: LBI17C1]

Sign In for Pricing
View Details
FusA Antibody
orb814093 2 mg

FusA Antibody

Sign In for Pricing
View Details
Hsa-miR-3618 miRNA Antagomir
CIJ1108-01 10 nmol

Hsa-miR-3618 miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-3618 miRNA Antagomir
CIJ1108-02 20 nmol

Hsa-miR-3618 miRNA Antagomir

Sign In for Pricing
View Details
Influenza A virus H1N1 Haemagglutinin Antigen
VAC-0314 0.5 mL

Influenza A virus H1N1 Haemagglutinin Antigen

Sign In for Pricing
View Details
C9orf114 Protein Lysate (Human) with C-Ha Tag
14770031 100 µg

C9orf114 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details