Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria BB3856 protein

This Bacteria BB3856 protein spans the amino acid sequence from region 22-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BB3856Azurin

UniProt

P0A321

Expression Region

22-150aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AECSVDIAGTDQMQFDKKAIEVSKSCKQFTVNLKHTGKLPRNVMGHNWVLTKTADMQAVEKDGIAAGLDNQYLKAGDTRVLAHTKVLGGGESDSVTFDVAKLAAGDDYTFFCSFPGHGALMKGTLKLVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Cy7 anti-human CD117 (c-kit)
E16FHN117-100 100 Tests

PE-Cy7 anti-human CD117 (c-kit)

Sign In for Pricing
View Details
NCAM1 Rabbit Monoclonal Antibody
E56G0346 100 µL

NCAM1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rat MKNK2 shRNA Plasmid
abx989000-01 150 µg

Rat MKNK2 shRNA Plasmid

Sign In for Pricing
View Details
Rat MKNK2 shRNA Plasmid
abx989000-02 300 µg

Rat MKNK2 shRNA Plasmid

Sign In for Pricing
View Details
Olfr1415 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4183206 1.0 µg DNA

Olfr1415 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Bovine Myeloma-overexpressed gene 2 protein, MYEOV2 ELISA Kit
MBS9341397-01 48 Well

Bovine Myeloma-overexpressed gene 2 protein, MYEOV2 ELISA Kit

Sign In for Pricing
View Details