Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria BB3856 protein

This Bacteria BB3856 protein spans the amino acid sequence from region 22-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BB3856Azurin

UniProt

P0A321

Expression Region

22-150aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AECSVDIAGTDQMQFDKKAIEVSKSCKQFTVNLKHTGKLPRNVMGHNWVLTKTADMQAVEKDGIAAGLDNQYLKAGDTRVLAHTKVLGGGESDSVTFDVAKLAAGDDYTFFCSFPGHGALMKGTLKLVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Box of 100 discs of standard filter 73g/m², 45 mm
ST62A0045 Box of 100

Box of 100 discs of standard filter 73g/m², 45 mm

Sign In for Pricing
View Details
PGP9.5 (UCHL1) (full length) rabbit polyclonal antibody, Aff - Purified
AP31182PU-N 250 µL

PGP9.5 (UCHL1) (full length) rabbit polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details
SKA2 sgRNA CRISPR Lentivector (Human) (Target 1)
K2804302 1.0 µg DNA

SKA2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Slug Rabbit mAb
C05136-100uL*2 2x 100μL

Slug Rabbit mAb

Sign In for Pricing
View Details
Canine ADAM9 ELISA Kit
ECA0738 96 Tests

Canine ADAM9 ELISA Kit

Sign In for Pricing
View Details
Phospho-GRK2 (Ser670) Polyclonal Antibody FITC Conjugated
orb1540737 100 µL

Phospho-GRK2 (Ser670) Polyclonal Antibody FITC Conjugated

Sign In for Pricing
View Details