Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Abrus precatorius Abrin-a protein

This Plant Abrus precatorius Abrin-a protein spans the amino acid sequence from region 1-251aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RRNA N-glycosidase

UniProt

P11140

Expression Region

1-251aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Abrus precatorius (Indian licorice) (Glycine abrus)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDRPIKFSTEGATSQSYKQFIEALRERLRGGLIHDIPVLPDPTTLQERNRYITVELSNSDTESIEVGIDVTNAYVVAYRAGTQSYFLRDAPSSASDYLFTGTDQHSLPFYGTYGDLERWAHQSRQQIPLGLQALTHGISFFRSGGNDNEEKARTLIVIIQMVAEAARFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFVCNPPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RPS15A activation kit by CRISPRa
GA104211 1 Kit

Human RPS15A activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Genomic DNA, Lung
CD564963 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details
CD93 (NM_012072) Human Recombinant Protein
TP306980L 1 mg

CD93 (NM_012072) Human Recombinant Protein

Sign In for Pricing
View Details
Aldolase A/B/C Recombinant Chimeric Antibody Antibody
HA610342 100 µL

Aldolase A/B/C Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
GMP Human IL-12 Protein
GMP-L12H23-500ug 500 µg

GMP Human IL-12 Protein

Sign In for Pricing
View Details
Human SLC41A3 activation kit by CRISPRa
GA110393 1 Kit

Human SLC41A3 activation kit by CRISPRa

Sign In for Pricing
View Details