Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli fkpA protein

This E. coli fkpA protein spans the amino acid sequence from region 26-270aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Rotamase yzzS

UniProt

P45523

Expression Region

26-270aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEAAKPATAADSKAAFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAPKADAKPEADAKAADSAKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cytokeratin 18 (ck-18) ELISA Kit
orb2811116-01 48 Tests

Human Cytokeratin 18 (ck-18) ELISA Kit

Sign In for Pricing
View Details
Human Cytokeratin 18 (ck-18) ELISA Kit
orb2811116-02 96 Tests

Human Cytokeratin 18 (ck-18) ELISA Kit

Sign In for Pricing
View Details
Human Cytokeratin 18 (ck-18) ELISA Kit
orb2811116-03 5 x 96 T

Human Cytokeratin 18 (ck-18) ELISA Kit

Sign In for Pricing
View Details
INPP5K Recombinant Protein (Mouse)
RP143915 100 µg

INPP5K Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Anti-JOSD2 Antibody Picoband®, Carrier-free
A14517-1-carrier-free 100 µg/Vial

Anti-JOSD2 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
MEAF6 (Chromatin Modification-related Protein MEAF6, MYST/Esa1-associated Factor 6)
485619 100 µL

MEAF6 (Chromatin Modification-related Protein MEAF6, MYST/Esa1-associated Factor 6)

Sign In for Pricing
View Details