Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human S100A10 protein

This Human S100A10 protein spans the amino acid sequence from region 1-97aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Calpactin I light chain Calpactin-1 light chain Cellular ligand of annexin II S100 calcium-binding protein A10 p10 protein p11 ANX2LG, CAL1L, CLP11

UniProt

P60903

Expression Region

1-97aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Antibody Discovery - Mouse M-CSF R / CSF1R / CD115 (20-511) Membrane Protein, PaRoom Temperatureial, -hIgG1 Fc tag
MP0672F Each

Magic™ Antibody Discovery - Mouse M-CSF R / CSF1R / CD115 (20-511) Membrane Protein, PaRoom Temperatureial, -hIgG1 Fc tag

Sign In for Pricing
View Details
Cipralisant
MBS5768902 Inquire

Cipralisant

Sign In for Pricing
View Details
Recombinant Legionella Pneumophila rplD Protein (aa 1-201) (strain Paris)
VAng-Lsx04131-1mgEcoli 1 mg (E. coli)

Recombinant Legionella Pneumophila rplD Protein (aa 1-201) (strain Paris)

Sign In for Pricing
View Details
Annexin V (FITC) Apoptosis Detection BioAssayTM Kit discontinued
219403 400Tests

Annexin V (FITC) Apoptosis Detection BioAssayTM Kit discontinued

Sign In for Pricing
View Details
CTLA4 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-10006R-BF488-TR 20 µL

CTLA4 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
AMZ1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
11868126 3x 1.0µg DNA

AMZ1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details