Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human S100A10 protein

This Human S100A10 protein spans the amino acid sequence from region 1-97aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Calpactin I light chain Calpactin-1 light chain Cellular ligand of annexin II S100 calcium-binding protein A10 p10 protein p11 ANX2LG, CAL1L, CLP11

UniProt

P60903

Expression Region

1-97aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEC1 Recombinant Antibody, PE-Cy7 Conjugated
bsm-61551R-PE-Cy7-01 20 µL

HEC1 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
HEC1 Recombinant Antibody, PE-Cy7 Conjugated
bsm-61551R-PE-Cy7-02 100 µL

HEC1 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
SYTL1 Protein, Human, Recombinant (His & Myc)
TMPH-04144-01 5 µg

SYTL1 Protein, Human, Recombinant (His & Myc)

Sign In for Pricing
View Details
SYTL1 Protein, Human, Recombinant (His & Myc)
TMPH-04144-02 10 µg

SYTL1 Protein, Human, Recombinant (His & Myc)

Sign In for Pricing
View Details
SYTL1 Protein, Human, Recombinant (His & Myc)
TMPH-04144-03 20 µg

SYTL1 Protein, Human, Recombinant (His & Myc)

Sign In for Pricing
View Details
SYTL1 Protein, Human, Recombinant (His & Myc)
TMPH-04144-04 50 µg

SYTL1 Protein, Human, Recombinant (His & Myc)

Sign In for Pricing
View Details