Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TLR7 protein

This Human TLR7 protein spans the amino acid sequence from region 861-1049aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PRO285, TLR 7, Tlr7, TLR7_HUMAN, Toll like receptor 7, Toll-like receptor 7, UNQ248

UniProt

Q9NYK1

Expression Region

861-1049aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTKDPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKYAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVAYSQVFKETV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBBX, NT (ZBBX, Zinc finger B-box domain-containing protein 1) (Azide free) (HRP)
MBS6364505-01 0.2 mL

ZBBX, NT (ZBBX, Zinc finger B-box domain-containing protein 1) (Azide free) (HRP)

Sign In for Pricing
View Details
ZBBX, NT (ZBBX, Zinc finger B-box domain-containing protein 1) (Azide free) (HRP)
MBS6364505-02 5x 0.2 mL

ZBBX, NT (ZBBX, Zinc finger B-box domain-containing protein 1) (Azide free) (HRP)

Sign In for Pricing
View Details
BRINP1 Rabbit Polyclonal Antibody (PerCP)
orb2284377 100 µL

BRINP1 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
HNRNPF Peptide
DF7383-BP 1 mg

HNRNPF Peptide

Sign In for Pricing
View Details
Olfr1484 Protein Vector (Mouse) (pPB-C-His)
PV209490 500 ng

Olfr1484 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Mouse Cenpo qPCR Primer Pair
QM26638S 200 Tests

Mouse Cenpo qPCR Primer Pair

Sign In for Pricing
View Details