Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TREX1 protein

This Human TREX1 protein spans the amino acid sequence from region 1-242aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

3'-5' exonuclease TREX1 Deoxyribonuclease III

UniProt

Q9NSU2

Expression Region

1-242aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGPGARRQGRIVQGRPEMCFCPPPTPLPPLRILTLGTHTPTPCSSPGSAAGTYPTMGSQALPPGPMQTLIFFDMEATGLPFSQPKVTELCLLAVHRCALESPPTSQGPPPTVPPPPRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYDFPLLQAELAMLGLTSALDGAFCVDSITALKALERASSPSEHGPRKSYSLGSIYTRLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGM 3 CRISPR Activation Plasmid (h)
sc-418062-ACT 20 µg

PGM 3 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
GIPR Antibody - N-terminal region : HRP (ARP63933_P050-HRP)
ARP63933_P050-HRP 100 µL

GIPR Antibody - N-terminal region : HRP (ARP63933_P050-HRP)

Sign In for Pricing
View Details
TNNI2 Protein Vector (Rat) (pPB-C-His)
PV312202 500 ng

TNNI2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Leptin (LEP)
SIPA055Rb01-01 10 µg

Recombinant Leptin (LEP)

Sign In for Pricing
View Details
Recombinant Leptin (LEP)
SIPA055Rb01-02 50 µg

Recombinant Leptin (LEP)

Sign In for Pricing
View Details
Recombinant Leptin (LEP)
SIPA055Rb01-03 200 µg

Recombinant Leptin (LEP)

Sign In for Pricing
View Details