Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ACVR2B protein

This Human ACVR2B protein spans the amino acid sequence from region 19-137aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin receptor type IIB Short name, ACTR-IIB

UniProt

Q13705, A0A2K5WUB0

Expression Region

19-137aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMG-1, acetylated (K12)
347462 100 µL

HMG-1, acetylated (K12)

Sign In for Pricing
View Details
Recombinant Clostridium Tetani prsA Protein (aa 27-339)
VAng-Lsx01723-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Tetani prsA Protein (aa 27-339)

Sign In for Pricing
View Details
Hsp27 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-52757R-BF405 100 µL

Hsp27 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Phospho-Tau (Thr205) Rabbit Polyclonal Antibody
orb7067-01 50 μL

Phospho-Tau (Thr205) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Tau (Thr205) Rabbit Polyclonal Antibody
orb7067-02 100 µL

Phospho-Tau (Thr205) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Tau (Thr205) Rabbit Polyclonal Antibody
orb7067-03 200 µL

Phospho-Tau (Thr205) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details