Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus APE3 protein

This Virus APE3 protein spans the amino acid sequence from region 57-537aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

APE3, YBR286W, YBR2024Aminopeptidase Y, EC 3.4.11.15

UniProt

P37302

Expression Region

57-537aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPKPHIPYFMKPHVESEKLQDKIKVDDLNATAWDLYRLANYSTPDYGHPTRVIGSKGHNKTMEYILNVFDDMQDYYDVSLQEFEALSGKIISFNLSDAETGKSFANTTAFALSPPVDGFVGKLVEIPNLGCEEKDYASVVPPRHNEKQIALIERGKCPFGDKSNLAGKFGFTAVVIYDNEPKSKEGLHGTLGEPTKHTVATVGVPYKVGKKLIANIALNIDYSLYFAMDSYVEFIKTQNIIADTKHGDPDNIVALGAHSDSVEEGPGINDDGSGTISLLNVAKQLTHFKINNKVRFAWWAAEEEGLLGSNFYAYNLTKEENSKIRVFMDYDMMASPNYEYEIYDANNKENPKGSEELKNLYVDYYKAHHLNYTLVPFDGRSDYVGFINNGIPAGGIATGAEKNNVNNGKVLDRCYHQLCDDVSNLSWDAFITNTKLIAHSVATYADSFEGFPKRETQKHKEVDILNAQQPQFKYRADFLII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit polyclonal RPL17 antibody (HRP)
MBS5307252-01 0.1 mg

Rabbit polyclonal RPL17 antibody (HRP)

Sign In for Pricing
View Details
Rabbit polyclonal RPL17 antibody (HRP)
MBS5307252-02 5x 0.1 mg

Rabbit polyclonal RPL17 antibody (HRP)

Sign In for Pricing
View Details
TTBK2 Rabbit Polyclonal Antibody (Cy5)
orb916028 100 µL

TTBK2 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
AMBN sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
11821111 3x 1.0 µg

AMBN sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Vom1r32 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6282306 1.0 µg DNA

Vom1r32 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Purified human CD3 Antibody
orb3065152-01 100 µg

Purified human CD3 Antibody

Sign In for Pricing
View Details