Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus APE3 protein

This Virus APE3 protein spans the amino acid sequence from region 57-537aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

APE3, YBR286W, YBR2024Aminopeptidase Y, EC 3.4.11.15

UniProt

P37302

Expression Region

57-537aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPKPHIPYFMKPHVESEKLQDKIKVDDLNATAWDLYRLANYSTPDYGHPTRVIGSKGHNKTMEYILNVFDDMQDYYDVSLQEFEALSGKIISFNLSDAETGKSFANTTAFALSPPVDGFVGKLVEIPNLGCEEKDYASVVPPRHNEKQIALIERGKCPFGDKSNLAGKFGFTAVVIYDNEPKSKEGLHGTLGEPTKHTVATVGVPYKVGKKLIANIALNIDYSLYFAMDSYVEFIKTQNIIADTKHGDPDNIVALGAHSDSVEEGPGINDDGSGTISLLNVAKQLTHFKINNKVRFAWWAAEEEGLLGSNFYAYNLTKEENSKIRVFMDYDMMASPNYEYEIYDANNKENPKGSEELKNLYVDYYKAHHLNYTLVPFDGRSDYVGFINNGIPAGGIATGAEKNNVNNGKVLDRCYHQLCDDVSNLSWDAFITNTKLIAHSVATYADSFEGFPKRETQKHKEVDILNAQQPQFKYRADFLII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ACE-2 Ectodomain Affinity Purified Polyclonal Ab
AF933-SP 25 µg

Human ACE-2 Ectodomain Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Rat Melanoma Marker A (MMA) ELISA Kit
MBS268984-01 48 Well

Rat Melanoma Marker A (MMA) ELISA Kit

Sign In for Pricing
View Details
Rat Melanoma Marker A (MMA) ELISA Kit
MBS268984-02 96 Well

Rat Melanoma Marker A (MMA) ELISA Kit

Sign In for Pricing
View Details
Rat Melanoma Marker A (MMA) ELISA Kit
MBS268984-03 5x 96 Well

Rat Melanoma Marker A (MMA) ELISA Kit

Sign In for Pricing
View Details
Rat Melanoma Marker A (MMA) ELISA Kit
MBS268984-04 10x 96 Well

Rat Melanoma Marker A (MMA) ELISA Kit

Sign In for Pricing
View Details
1- (3-methoxy-5-methylphenyl) -2-methylpropan-1-ol
OR1081425-01 250 mg

1- (3-methoxy-5-methylphenyl) -2-methylpropan-1-ol

Sign In for Pricing
View Details