Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SFTPA1 protein

This Human SFTPA1 protein spans the amino acid sequence from region 21-248aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

35 kDa pulmonary surfactant-associated protein Alveolar proteinosis protein Collectin-4 COLEC4, PSAP, SFTP1, SFTPA, SFTPA1B

UniProt

Q8IWL2

Expression Region

21-248aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Euscaphic Acid
TRC-E939500-5MG 5 mg

Euscaphic Acid

Sign In for Pricing
View Details
IKK alpha Recombinant Rabbit monoclonal Antibody
HA750246 100 µL

IKK alpha Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS806833 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
FDXR Polyclonal Antibody
E-AB-19061-01 20 µL

FDXR Polyclonal Antibody

Sign In for Pricing
View Details
FDXR Polyclonal Antibody
E-AB-19061-02 60 µL

FDXR Polyclonal Antibody

Sign In for Pricing
View Details
FDXR Polyclonal Antibody
E-AB-19061-03 120 µL

FDXR Polyclonal Antibody

Sign In for Pricing
View Details