Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SFTPA1 protein

This Human SFTPA1 protein spans the amino acid sequence from region 21-248aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

35 kDa pulmonary surfactant-associated protein Alveolar proteinosis protein Collectin-4 COLEC4, PSAP, SFTP1, SFTPA, SFTPA1B

UniProt

Q8IWL2

Expression Region

21-248aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD13D (NM_207354) Human Over-expression Lysate
LY403977 100 µg

ANKRD13D (NM_207354) Human Over-expression Lysate

Sign In for Pricing
View Details
GART Rabbit Polyclonal Antibody
TA376484 100 µL

GART Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2,4,6-Trifluorobenzonitrile-15N
TRC-T790027-1G 1 g

2,4,6-Trifluorobenzonitrile-15N

Sign In for Pricing
View Details
Recombinant Human FcRn & B2M Heterodimer Protein (His Tag)
PKSH032422-01 10 µg

Recombinant Human FcRn & B2M Heterodimer Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FcRn & B2M Heterodimer Protein (His Tag)
PKSH032422-02 50 µg

Recombinant Human FcRn & B2M Heterodimer Protein (His Tag)

Sign In for Pricing
View Details
Mouse Gpatch11 activation kit by CRISPRa
GA205624 1 Kit

Mouse Gpatch11 activation kit by CRISPRa

Sign In for Pricing
View Details