Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SFTPA1 protein

This Human SFTPA1 protein spans the amino acid sequence from region 21-248aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

35 kDa pulmonary surfactant-associated protein Alveolar proteinosis protein Collectin-4 COLEC4, PSAP, SFTP1, SFTPA, SFTPA1B

UniProt

Q8IWL2

Expression Region

21-248aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF405S conjugate, 0.1mg/mL
BNC042400-500 1x 500 µL

OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SCARF2 activation kit by CRISPRa
GA114093 1 Kit

Human SCARF2 activation kit by CRISPRa

Sign In for Pricing
View Details
2,6-Diamino-2,3,6-trideoxy-D-ribo-Hexose Di-TFA Salt
TRC-D416715-1MG 1 mg

2,6-Diamino-2,3,6-trideoxy-D-ribo-Hexose Di-TFA Salt

Sign In for Pricing
View Details
Magnesium Bromide
TRC-M110385-250MG 250 mg

Magnesium Bromide

Sign In for Pricing
View Details
SIRT1 Antibody (Biotin)
KB-974-01 50 μL

SIRT1 Antibody (Biotin)

Sign In for Pricing
View Details
SIRT1 Antibody (Biotin)
KB-974-02 100 µL

SIRT1 Antibody (Biotin)

Sign In for Pricing
View Details