E. coli fimH protein
This E. coli fimH protein spans the amino acid sequence from region 22-300aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
FimH, b4320, JW4283Type 1 fimbrin D-mannose specific adhesin, Protein FimH
UniProt
P08191
Expression Region
22-300aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Escherichia coli (strain K12)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
33.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-UNEL-H0145-01 5x 96 Tests
Uncoated Human Flt3L (FMS-like Tyrosine Kinase 3 Ligand) ELISA Kit
Sign In for Pricing
View Details E-UNEL-H0145-02 15x 96 Tests
Uncoated Human Flt3L (FMS-like Tyrosine Kinase 3 Ligand) ELISA Kit
Sign In for Pricing
View Details 
AP21176PU-N 100 µg
GABA A Receptor delta (GABRD) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 