Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Spink2 protein

This Mouse Spink2 protein spans the amino acid sequence from region 17-86aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Spink2, Serine protease inhibitor Kazal-type 2

UniProt

Q8BMY7

Expression Region

17-86aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HETLDSSDSQIMKRSQFRTPDCGHFDFPACPRNLNPVCGTDMNTYSNECTLCMKIREDGSHINIIKDEPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Active Recombinant Mouse Epha3 Protein, Fc-tagged, Alexa Fluor 555 conjugated
Epha3-494MAF555 20 μg- 50 μg- 100 μg

Active Recombinant Mouse Epha3 Protein, Fc-tagged, Alexa Fluor 555 conjugated

Sign In for Pricing
View Details
Rabbit IL-4 (Interleukin 4) ValidElisa Kit
EK346572 96 Well

Rabbit IL-4 (Interleukin 4) ValidElisa Kit

Sign In for Pricing
View Details
SPTB Rabbit pAb
E45R19643N 50 ul

SPTB Rabbit pAb

Sign In for Pricing
View Details
RPS26P30 3'UTR Lenti-reporter-Luc Vector
42317081 1.0 µg

RPS26P30 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
3,4-Dihydronaphthalen-1 (2H) -one Oxime
orb3029841-01 2 g

3,4-Dihydronaphthalen-1 (2H) -one Oxime

Sign In for Pricing
View Details
3,4-Dihydronaphthalen-1 (2H) -one Oxime
orb3029841-02 50 mg

3,4-Dihydronaphthalen-1 (2H) -one Oxime

Sign In for Pricing
View Details