Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Spink2 protein

This Mouse Spink2 protein spans the amino acid sequence from region 17-86aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Spink2, Serine protease inhibitor Kazal-type 2

UniProt

Q8BMY7

Expression Region

17-86aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HETLDSSDSQIMKRSQFRTPDCGHFDFPACPRNLNPVCGTDMNTYSNECTLCMKIREDGSHINIIKDEPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal KIST Antibody (OTI2H4) [PE/Atto594]
NBP2-72383PEATT594 0.1 mL

Mouse Monoclonal KIST Antibody (OTI2H4) [PE/Atto594]

Sign In for Pricing
View Details
TLK2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F9]
TA805461AM 100 µL

TLK2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F9]

Sign In for Pricing
View Details
FLJ22675 Lentiviral Activation Particles (h)
sc-415201-LAC 200 µL

FLJ22675 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
TIGIT, Fc Chimera, Recombinant, Mouse, CF (T-cell Immunoreceptor with Ig and ITIM Domains, V-set and Transmembrane Domain-containing Protein 3, Vstm3)
T5499-30 50 µg

TIGIT, Fc Chimera, Recombinant, Mouse, CF (T-cell Immunoreceptor with Ig and ITIM Domains, V-set and Transmembrane Domain-containing Protein 3, Vstm3)

Sign In for Pricing
View Details
Rat HSP90α ELISA Kit
E108530 1 Each

Rat HSP90α ELISA Kit

Sign In for Pricing
View Details
ESRRG antibody - N-terminal region (ARP45602_P050)
ARP45602_P050 100 µL

ESRRG antibody - N-terminal region (ARP45602_P050)

Sign In for Pricing
View Details