Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Spink2 protein

This Mouse Spink2 protein spans the amino acid sequence from region 17-86aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Spink2, Serine protease inhibitor Kazal-type 2

UniProt

Q8BMY7

Expression Region

17-86aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HETLDSSDSQIMKRSQFRTPDCGHFDFPACPRNLNPVCGTDMNTYSNECTLCMKIREDGSHINIIKDEPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cucumarioside A6-2
orb1983674-01 100 mg

Cucumarioside A6-2

Sign In for Pricing
View Details
Cucumarioside A6-2
orb1983674-02 500 mg

Cucumarioside A6-2

Sign In for Pricing
View Details
Human coronavirus HKU1 N protein [His]
DAGB103 100 ug

Human coronavirus HKU1 N protein [His]

Sign In for Pricing
View Details
PHLDB1 (NM_001144759) Human Tagged ORF Clone Lentiviral Particle
RC227727L3V 200 µL

PHLDB1 (NM_001144759) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-Rb1 Antibody Clone 1F8, Unconjugated-20ug
5925-MSM1-P0 20ug

Anti-Rb1 Antibody Clone 1F8, Unconjugated-20ug

Sign In for Pricing
View Details
Human ATP2B4 knockdown cell line
ABC-KD1184 1 Vial

Human ATP2B4 knockdown cell line

Sign In for Pricing
View Details