Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Caprin2 protein

This Rat Caprin2 protein spans the amino acid sequence from region 894-1028aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LOC686779

UniProt

M0R6B1

Expression Region

894-1028aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PQQMRVAFSAARTSNLAPGTLDQPIVFDLLLNNLGETFDLQLGRFNCPVNGTYVFIFHMLKLAVNVPLYVNLMKNEEVLVSAYANDGAPDHETASNHAILQLLQGDQIWLRLHRGAIYGSSWKYSTFSGYLLYQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMC1 (Armadillo Repeat-containing Protein 1, ARCP, FLJ10511) (HRP)
MBS6151276-01 0.1 mL

ARMC1 (Armadillo Repeat-containing Protein 1, ARCP, FLJ10511) (HRP)

Sign In for Pricing
View Details
ARMC1 (Armadillo Repeat-containing Protein 1, ARCP, FLJ10511) (HRP)
MBS6151276-02 5x 0.1 mL

ARMC1 (Armadillo Repeat-containing Protein 1, ARCP, FLJ10511) (HRP)

Sign In for Pricing
View Details
Inosine triphosphate pyrophosphatase (ITPA) (NM_033453) Human Recombinant Protein
TP304021L 1 mg

Inosine triphosphate pyrophosphatase (ITPA) (NM_033453) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Chlamydophila abortus Serine/threonine-protein kinase pknD (pknD), partial
MBS1444192 Inquire

Recombinant Chlamydophila abortus Serine/threonine-protein kinase pknD (pknD), partial

Sign In for Pricing
View Details
CLEC4M (C-type Lectin Domain Family 4 Member M, CD209 Antigen-like Protein 1, DC-SIGN-related Protein, DC-SIGNR, Dendritic Cell-specific ICAM-3-grabbing Non-integrin 2, DC-SIGN2, Liver/Lymph Node-specific ICAM-3-grabbing Non-integrin, L-SIGN, CD299, CD209L, CD209L1, MGC129964, MGC47866) (MaxLight 490)
137851-ML490 100 µL

CLEC4M (C-type Lectin Domain Family 4 Member M, CD209 Antigen-like Protein 1, DC-SIGN-related Protein, DC-SIGNR, Dendritic Cell-specific ICAM-3-grabbing Non-integrin 2, DC-SIGN2, Liver/Lymph Node-specific ICAM-3-grabbing Non-integrin, L-SIGN, CD299, CD209L, CD209L1, MGC129964, MGC47866) (MaxLight 490)

Sign In for Pricing
View Details
Lentiviral human ARHGAP30 sgRNA gene knockout kit - Lentiviral human ARHGAP30 sgRNA gene knockout kit (plasmid)
GTR15384791 1 Vial

Lentiviral human ARHGAP30 sgRNA gene knockout kit - Lentiviral human ARHGAP30 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details