Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Caprin2 protein

This Rat Caprin2 protein spans the amino acid sequence from region 894-1028aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LOC686779

UniProt

M0R6B1

Expression Region

894-1028aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PQQMRVAFSAARTSNLAPGTLDQPIVFDLLLNNLGETFDLQLGRFNCPVNGTYVFIFHMLKLAVNVPLYVNLMKNEEVLVSAYANDGAPDHETASNHAILQLLQGDQIWLRLHRGAIYGSSWKYSTFSGYLLYQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPC3 Mouse Monoclonal Antibody [Clone ID: 15G1]
TA399833 0.2 mg

GPC3 Mouse Monoclonal Antibody [Clone ID: 15G1]

Sign In for Pricing
View Details
Recombinant Human Cdc6 Protein - (Dry Ice)
H00000990-P01-2ug 2 µg

Recombinant Human Cdc6 Protein - (Dry Ice)

Sign In for Pricing
View Details
RHEB (NM_005614) Human Recombinant Protein
E45H42116M5 20 µg

RHEB (NM_005614) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Alpha mannosidase 2x (MAN2A2) ELISA Kit
GTR10331264 96 Well

Rabbit Alpha mannosidase 2x (MAN2A2) ELISA Kit

Sign In for Pricing
View Details
C6orf115 Double Nickase Plasmid (h)
sc-412922-NIC 20 µg

C6orf115 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
pLV3-CMV-ECFP-S1PR4-EF1a-Puro Plasmid
PVT46505 2 µg

pLV3-CMV-ECFP-S1PR4-EF1a-Puro Plasmid

Sign In for Pricing
View Details