Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli mrcB protein

This E. coli mrcB protein spans the amino acid sequence from region 444-736aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Murein polymerase pbpF, ponB

UniProt

P02919

Expression Region

444-736aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTITWVGRDNNQPTKLYGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrtm2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4581404 1.0 µg DNA

Lrtm2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Armenian Hamster Monoclonal B7-1/CD80 Antibody (16-10A1) [PE/Cy5.5]
NBP1-43385PECY55 0.1 mL

Armenian Hamster Monoclonal B7-1/CD80 Antibody (16-10A1) [PE/Cy5.5]

Sign In for Pricing
View Details
Procollagen type I (CT) (human) monoclonal antibody (8)
BPD-BTE-002-08-1 1 mg

Procollagen type I (CT) (human) monoclonal antibody (8)

Sign In for Pricing
View Details
Recombinant Rat S100A9
MBS7609975-01 0.05 mg

Recombinant Rat S100A9

Sign In for Pricing
View Details
Recombinant Rat S100A9
MBS7609975-02 0.2 mg

Recombinant Rat S100A9

Sign In for Pricing
View Details
Recombinant Rat S100A9
MBS7609975-03 1 mg

Recombinant Rat S100A9

Sign In for Pricing
View Details