Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli mrcB protein

This E. coli mrcB protein spans the amino acid sequence from region 444-736aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Murein polymerase pbpF, ponB

UniProt

P02919

Expression Region

444-736aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTITWVGRDNNQPTKLYGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHG36 rabbit pAb Antibody
orb2304064-01 50 µL

RHG36 rabbit pAb Antibody

Sign In for Pricing
View Details
RHG36 rabbit pAb Antibody
orb2304064-02 100 µL

RHG36 rabbit pAb Antibody

Sign In for Pricing
View Details
LAPTM4B Antibody
A59878-50UG 50 µg

LAPTM4B Antibody

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae idi Protein (aa 1-184)
VAng-Cr4886-50gEcoli 50 µg (E. coli)

Recombinant Klebsiella Pneumoniae idi Protein (aa 1-184)

Sign In for Pricing
View Details
4-Chloro-3- (propan-2-yl) -1H-pyrazolo[4,3-c]pyridine
SZB24945-01 50 mg

4-Chloro-3- (propan-2-yl) -1H-pyrazolo[4,3-c]pyridine

Sign In for Pricing
View Details
4-Chloro-3- (propan-2-yl) -1H-pyrazolo[4,3-c]pyridine
SZB24945-02 0.5 g

4-Chloro-3- (propan-2-yl) -1H-pyrazolo[4,3-c]pyridine

Sign In for Pricing
View Details