Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus ftnA protein

This Virus ftnA protein spans the amino acid sequence from region 1-167aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pfr

UniProt

P52093

Expression Region

1-167aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGFB Rabbit Polyclonal Antibody (BF750)
orb1597717 100 µL

NGFB Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Mouse SYT8 shRNA Plasmid
abx974554-01 150 µg

Mouse SYT8 shRNA Plasmid

Sign In for Pricing
View Details
Mouse SYT8 shRNA Plasmid
abx974554-02 300 µg

Mouse SYT8 shRNA Plasmid

Sign In for Pricing
View Details
Thyroid peroxidase Polyclonal Antibody, PE-Cy5 Conjugated
bs-10406R-PE-Cy5-TR 20 µL

Thyroid peroxidase Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
PGC Mouse mAb, Pacific Blue conjugated
orb2819928 100 µL

PGC Mouse mAb, Pacific Blue conjugated

Sign In for Pricing
View Details
PepQ Antibody
orb823776 2 mg

PepQ Antibody

Sign In for Pricing
View Details