Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus ftnA protein

This Virus ftnA protein spans the amino acid sequence from region 1-167aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pfr

UniProt

P52093

Expression Region

1-167aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aipl1 Rat shRNA Plasmid (Locus ID 59110)
TR710444 1 Kit

Aipl1 Rat shRNA Plasmid (Locus ID 59110)

Sign In for Pricing
View Details
Ccdc117 (NM_134033) Mouse Untagged Clone
MC205518 10 µg

Ccdc117 (NM_134033) Mouse Untagged Clone

Sign In for Pricing
View Details
Rabbit ABC50 Antibody
orb1527411-01 10 µL

Rabbit ABC50 Antibody

Sign In for Pricing
View Details
Rabbit ABC50 Antibody
orb1527411-02 100 µL

Rabbit ABC50 Antibody

Sign In for Pricing
View Details
Mrpl51 (NM_025595) Mouse Tagged Lenti ORF Clone
MR200698L4 10 µg

Mrpl51 (NM_025595) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ESS2 (NM_022719) Human Over-expression Lysate
E45H11749-2 20 µg

ESS2 (NM_022719) Human Over-expression Lysate

Sign In for Pricing
View Details