Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus ftnA protein

This Virus ftnA protein spans the amino acid sequence from region 1-167aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pfr

UniProt

P52093

Expression Region

1-167aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3orf59 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0232806 1.0 µg DNA

C3orf59 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
RHCG Recombinant Protein (Mouse)
RP167984 100 µg

RHCG Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Olr1684-set siRNA/shRNA/RNAi Lentivector (Rat)
34136096 4x 500 ng

Olr1684-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Anti-Niemann Pick C1/NPC1 Antibody Picoband® (Biotine Conjugate)
A00428-3-Biotin 100 µg/Vial

Anti-Niemann Pick C1/NPC1 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
CUTA Rabbit Polyclonal Antibody
E310528 100 µg - 200 µL

CUTA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Kif3b Mouse Pre-designed siRNA Set A
HY-RS22596 1 Set

Kif3b Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details