Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine PPP1CA protein

This Canine PPP1CA protein spans the amino acid sequence from region 2-330aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PPP1CA, Serine/threonine-protein phosphatase PP1-alpha catalytic subunit, PP-1A, EC 3.1.3.16

UniProt

Q8WMS6

Expression Region

2-330aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDSFNSLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Testosterone discontinued
T2950-26 5000 Tests

Testosterone discontinued

Sign In for Pricing
View Details
Glycerol-3-phosphate (G3P) Fluorometric Assay Kit
MBS2576274-01 48 Tests

Glycerol-3-phosphate (G3P) Fluorometric Assay Kit

Sign In for Pricing
View Details
Glycerol-3-phosphate (G3P) Fluorometric Assay Kit
MBS2576274-02 96 Tests

Glycerol-3-phosphate (G3P) Fluorometric Assay Kit

Sign In for Pricing
View Details
Glycerol-3-phosphate (G3P) Fluorometric Assay Kit
MBS2576274-03 5x 96 Tests

Glycerol-3-phosphate (G3P) Fluorometric Assay Kit

Sign In for Pricing
View Details
POLR2F Rabbit pAb
MBS8544609-01 0.1 mL

POLR2F Rabbit pAb

Sign In for Pricing
View Details
POLR2F Rabbit pAb
MBS8544609-02 0.1 mL (AF405L)

POLR2F Rabbit pAb

Sign In for Pricing
View Details