Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pla2g15 protein

This Mouse Pla2g15 protein spans the amino acid sequence from region 34-412aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1-O-acylceramide synthase1 Short name, ACS LCAT-like lysophospholipase Short name, LLPL Lysophospholipase 3 Lysosomal phospholipase A22 Short name, LPLA2

UniProt

Q8VEB4

Expression Region

34-412aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACAD8 Antibody (Center) Blocking Peptide
MBS9228236-01 0.5 mg

ACAD8 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
ACAD8 Antibody (Center) Blocking Peptide
MBS9228236-02 5x 0.5 mg

ACAD8 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
Pcp4 3'UTR Luciferase Stable Cell Line
TU116062 1.0 mL

Pcp4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
RALGAPB Protein Vector (Human) (pPM-C-His)
PV114749 500 ng

RALGAPB Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human SURF1 qPCR Primer Pair
QH23541S 200 Tests

Human SURF1 qPCR Primer Pair

Sign In for Pricing
View Details
Entpd8 3'UTR GFP Stable Cell Line
TU155846 1.0 mL

Entpd8 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details