Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL1 alpha protein

This Human IL1 alpha protein spans the amino acid sequence from region 113-271aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hematopoietin-1 IL1F1

UniProt

P01583

Expression Region

113-271aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ACAA1 Protein
orb423918-01 5 µg

Human ACAA1 Protein

Sign In for Pricing
View Details
Human ACAA1 Protein
orb423918-02 20 µg

Human ACAA1 Protein

Sign In for Pricing
View Details
Human ACAA1 Protein
orb423918-03 1 mg

Human ACAA1 Protein

Sign In for Pricing
View Details
Deterenol sulfate
orb2815457-01 50 mg

Deterenol sulfate

Sign In for Pricing
View Details
Deterenol sulfate
orb2815457-02 10 mg

Deterenol sulfate

Sign In for Pricing
View Details
ICAM5 Rabbit Polyclonal Antibody (Fluoro594)
orb3100636 100 µg

ICAM5 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details