Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi PRA1 protein

This Fungi PRA1 protein spans the amino acid sequence from region 16-299aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

58 kDa fibrinogen-binding mannoprotein FBP1

UniProt

P87020

Expression Region

16-299aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Infectious Disease & Virology; Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APVTVTRFVDASPTGYDWRADWVKGFPIDSSCNATQYNQLSTGLQEAQLLAEHARDHTLRFGSKSPFFRKYFGNETASAEVVGHFDNVVGADKSSILFLCDDLDDKCKNDGWAGYWRGSNHSDQTIICDLSFVTRRYLTQLCSSGYTVSKSKTNIFWAGDLLHRFWHLKSIGQLVIEHYADTYEEVLELAQENSTYAVRNSNSLIYYALDVYAYDVTIPGEGCNGDGTSYKKSDFSSFEDSDSGSDSGASSTASSSHQHTDSNPSATTDANSHCHTHADGEVHC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

24-Epicerebrosterol
TRC-E582280-50MG 50 mg

24-Epicerebrosterol

Sign In for Pricing
View Details
GJA8 (NM_005267) Human Recombinant Protein
TP313469 20 µg

GJA8 (NM_005267) Human Recombinant Protein

Sign In for Pricing
View Details
MTF1 (MTF1/2649), CF640R conjugate, 0.1mg/mL
BNC402649-100 1x 100 µL

MTF1 (MTF1/2649), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant CLIC4 Antibody
RC-4782-01 50 μL

Recombinant CLIC4 Antibody

Sign In for Pricing
View Details
Recombinant CLIC4 Antibody
RC-4782-02 100 µL

Recombinant CLIC4 Antibody

Sign In for Pricing
View Details
Recombinant CLIC4 Antibody
RC-4782-03 1 mL

Recombinant CLIC4 Antibody

Sign In for Pricing
View Details