Fungi PRA1 protein
This Fungi PRA1 protein spans the amino acid sequence from region 16-299aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
58 kDa fibrinogen-binding mannoprotein FBP1
UniProt
P87020
Expression Region
16-299aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Field of Research
Infectious Disease & Virology; Neuroscience
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
33.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
APVTVTRFVDASPTGYDWRADWVKGFPIDSSCNATQYNQLSTGLQEAQLLAEHARDHTLRFGSKSPFFRKYFGNETASAEVVGHFDNVVGADKSSILFLCDDLDDKCKNDGWAGYWRGSNHSDQTIICDLSFVTRRYLTQLCSSGYTVSKSKTNIFWAGDLLHRFWHLKSIGQLVIEHYADTYEEVLELAQENSTYAVRNSNSLIYYALDVYAYDVTIPGEGCNGDGTSYKKSDFSSFEDSDSGSDSGASSTASSSHQHTDSNPSATTDANSHCHTHADGEVHC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PE/Elab Fluor® 594 Rat IgG2a, λ Isotype Control[B39-4]](https://cdn.genprice.uk/products/763/68dd14a5061270361e7d151b/imageurl/e-ab-f09742p.webp)
E-AB-F09742P-01 20 Tests
PE/Elab Fluor® 594 Rat IgG2a, λ Isotype Control[B39-4]
Sign In for Pricing
View Details E-AB-F09742P-02 100 Tests
PE/Elab Fluor® 594 Rat IgG2a, λ Isotype Control[B39-4]
Sign In for Pricing
View Details E-AB-F09742P-03 2x 100 Tests
PE/Elab Fluor® 594 Rat IgG2a, λ Isotype Control[B39-4]
Sign In for Pricing
View Details 
