Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus M protein

This Virus M protein spans the amino acid sequence from region 1-202aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphoprotein M2

UniProt

P15200

Expression Region

1-202aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Rabies virus (strain PM1503/AVO1) (RABV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNVLRKIVKKCRDEDTQKPSPVSAPPDDDDLWLPPPEYVPLKELTSKKNMRNFCVNGDVKACSPNGYSFRILRHILRSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVSARQCHIQGRIWCINTNSRACQLWSDMSLQTQRSEEDKDSSLLLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFAND5 Rabbit pAb, PE-Cy5 conjugated
orb2881477 100 µL

ZFAND5 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
Gnmt ORF Vector (Rat) (pORF)
ORF067686 1.0 µg DNA

Gnmt ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Porcine Corticosterone (CORT) ELISA Kit-Sandwich
EK11F244-01 48 Test

Porcine Corticosterone (CORT) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Porcine Corticosterone (CORT) ELISA Kit-Sandwich
EK11F244-02 96 Tests

Porcine Corticosterone (CORT) ELISA Kit-Sandwich

Sign In for Pricing
View Details
TIMMDC1 polyclonal antibody
BS72776-01 50 µL

TIMMDC1 polyclonal antibody

Sign In for Pricing
View Details
TIMMDC1 polyclonal antibody
BS72776-02 100 µL

TIMMDC1 polyclonal antibody

Sign In for Pricing
View Details