Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TMEM132A protein

This Human TMEM132A protein spans the amino acid sequence from region 642-742aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HSPA5-binding protein 1 HSPA5BP1, KIAA1583

UniProt

Q24JP5

Expression Region

642-742aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QPVMGISLTLSRGTAHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRRDLGLSVSAEEPGAILPAEEQGAQLGVVVSGAGAEGLPLHVAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Lactate Dehydrogenase (L-Lactate Dehydrogenase A Chain, LDHA, LDH-A, L-Lactic Dehydrogenase, LDH, LDH Muscle Subunit, LDH-M)
L1011-21J 5 mg

L-Lactate Dehydrogenase (L-Lactate Dehydrogenase A Chain, LDHA, LDH-A, L-Lactic Dehydrogenase, LDH, LDH Muscle Subunit, LDH-M)

Sign In for Pricing
View Details
Rat Plasmin/antiplasmin complex ELISA Kit
MBS727739-01 48 Well

Rat Plasmin/antiplasmin complex ELISA Kit

Sign In for Pricing
View Details
Rat Plasmin/antiplasmin complex ELISA Kit
MBS727739-02 96 Well

Rat Plasmin/antiplasmin complex ELISA Kit

Sign In for Pricing
View Details
Rat Plasmin/antiplasmin complex ELISA Kit
MBS727739-03 5x 96 Well

Rat Plasmin/antiplasmin complex ELISA Kit

Sign In for Pricing
View Details
Rat Plasmin/antiplasmin complex ELISA Kit
MBS727739-04 10x 96 Well

Rat Plasmin/antiplasmin complex ELISA Kit

Sign In for Pricing
View Details
NBD sphingosine
ZHC37025 1 mg

NBD sphingosine

Sign In for Pricing
View Details