Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD63 protein

This Human CD63 protein spans the amino acid sequence from region 103-203aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Granulophysin Lysosomal-associated membrane protein 3 Short name, LAMP-3 Melanoma-associated antigen ME491 OMA81H Ocular melanoma-associated antigen Tetraspanin-30 Short name, Tspan-30 CD_antigen, CD63 MLA1, TSPAN30

UniProt

P08962

Expression Region

103-203aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC22A Lentiviral Activation Particles (m)
sc-435547-LAC 200 µL

SEC22A Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Mouse Monoclonal MAGEA4 Antibody (CPTC-MAGEA4-1) [DyLight 594]
NBP2-79861DL594 0.1 mL

Mouse Monoclonal MAGEA4 Antibody (CPTC-MAGEA4-1) [DyLight 594]

Sign In for Pricing
View Details
ASPN Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
12566065 1.0 µg DNA

ASPN Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
N- (3-Methoxybenzyl) oleamide
361828-01 10 mg

N- (3-Methoxybenzyl) oleamide

Sign In for Pricing
View Details
N- (3-Methoxybenzyl) oleamide
361828-02 20 mg

N- (3-Methoxybenzyl) oleamide

Sign In for Pricing
View Details
MACOI, NT (TMEM57, Macoilin, Transmembrane protein 57) (MaxLight 750)
MBS6317899-01 0.1 mL

MACOI, NT (TMEM57, Macoilin, Transmembrane protein 57) (MaxLight 750)

Sign In for Pricing
View Details