Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Reg3b protein

This Rat Reg3b protein spans the amino acid sequence from region 27-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pancreatitis-associated protein 1, Peptide 23REG-2Regenerating islet-derived protein III-beta , Reg III-beta

UniProt

P25031

Expression Region

27-175aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics, Immunology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CTPS2 Pre-designed siRNA Set A
SI003776A 1 Each

Human CTPS2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Human NINJ1
orb1714606-01 50 µg

Recombinant Human NINJ1

Sign In for Pricing
View Details
Recombinant Human NINJ1
orb1714606-02 100 µg

Recombinant Human NINJ1

Sign In for Pricing
View Details
Recombinant Human NINJ1
orb1714606-03 200 µg

Recombinant Human NINJ1

Sign In for Pricing
View Details
Recombinant Human NINJ1
orb1714606-04 1 mg

Recombinant Human NINJ1

Sign In for Pricing
View Details
Recombinant Mouse EG VEGF
MBS7610489-01 0.05 mg

Recombinant Mouse EG VEGF

Sign In for Pricing
View Details