Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Reg3b protein

This Rat Reg3b protein spans the amino acid sequence from region 27-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pancreatitis-associated protein 1, Peptide 23REG-2Regenerating islet-derived protein III-beta , Reg III-beta

UniProt

P25031

Expression Region

27-175aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics, Immunology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat 8-isoprostane,8-iso-PGF2A ELISA KIT
EA0141Ra 96 Well

Rat 8-isoprostane,8-iso-PGF2A ELISA KIT

Sign In for Pricing
View Details
TC-H 106
C12167-25mg 25 mg

TC-H 106

Sign In for Pricing
View Details
N-Acetylaminomethylphosphoric Acid
165326 1 g

N-Acetylaminomethylphosphoric Acid

Sign In for Pricing
View Details
Sockets, 4mm, For Banana Plugs
2020480/1 1 Each

Sockets, 4mm, For Banana Plugs

Sign In for Pricing
View Details
RBPMS Peptide
orb2017756 100 µg

RBPMS Peptide

Sign In for Pricing
View Details
Anti-Phospho-Tau (Ser404) Rabbit Monoclonal Antibody
MA4563-.05 50 µL

Anti-Phospho-Tau (Ser404) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details