What is the catalog number for Human IFNA6 protein?

The catalog number for Human IFNA6 protein is orb604175.

What sizes are available for Human IFNA6 protein?

Human IFNA6 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human IFNA6 protein come in?

Human IFNA6 protein is available in 3 different pack sizes.

Is Human IFNA6 protein in stock?

Human IFNA6 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human IFNA6 protein

This Human IFNA6 protein spans the amino acid sequence from region 21-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon alpha-54 Interferon alpha-K Short name, LeIF K

UniProt

P05013

Expression Region

21-189aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE