Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFNA6 protein

This Human IFNA6 protein spans the amino acid sequence from region 21-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon alpha-54 Interferon alpha-K Short name, LeIF K

UniProt

P05013

Expression Region

21-189aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ATP-dependent zinc metalloprotease YME1L1 (YME1L1) ELISA Kit
orb1657669-01 48 Tests

Human ATP-dependent zinc metalloprotease YME1L1 (YME1L1) ELISA Kit

Sign In for Pricing
View Details
Human ATP-dependent zinc metalloprotease YME1L1 (YME1L1) ELISA Kit
orb1657669-02 96 Tests

Human ATP-dependent zinc metalloprotease YME1L1 (YME1L1) ELISA Kit

Sign In for Pricing
View Details
Human H3-3A Pre-designed siRNA Set A
SI006843A 1 Each

Human H3-3A Pre-designed siRNA Set A

Sign In for Pricing
View Details
Ku 70 Conjugated Antibody
orb1611548 100 µL

Ku 70 Conjugated Antibody

Sign In for Pricing
View Details
Lentiviral human AP1AR sgRNA gene knockout kit - Lentiviral human AP1AR sgRNA gene knockout kit (100)
GTR15378181 1 Vial

Lentiviral human AP1AR sgRNA gene knockout kit - Lentiviral human AP1AR sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
TJP2 Rabbit Polyclonal Antibody (FITC)
orb465481 100 µL

TJP2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details