Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Adipoq protein

This Mouse Adipoq protein spans the amino acid sequence from region 18-247aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

30KDA adipocyte complement-related protein, Adipocyte complement-related 30KDA protein , ACRP30Adipocyte, C1q and collagen domain-containing protein, Adipocyte-specific protein AdipoQ

UniProt

Q60994

Expression Region

18-247aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDN12 Protein Lysate (Human) with C-Ha Tag
16266031 100 µg

CLDN12 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Sirt1 Antibody
orb807537 2 mg

Sirt1 Antibody

Sign In for Pricing
View Details
Phospho-Histone H3 (Ser10) Rabbit Polyclonal Antibody (BF350)
orb1592968 100 µL

Phospho-Histone H3 (Ser10) Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
FUSSEL18, CT (SKOR2, CORL2, FUSSEL18, SKI family transcriptional corepressor 2, Functional Smad-suppressing element on chromosome 18, LBX1 corepressor 1-like protein, Ladybird homeobox corepressor 1-like protein) (Biotin) discontinued
035796-Biotin 200 µL

FUSSEL18, CT (SKOR2, CORL2, FUSSEL18, SKI family transcriptional corepressor 2, Functional Smad-suppressing element on chromosome 18, LBX1 corepressor 1-like protein, Ladybird homeobox corepressor 1-like protein) (Biotin) discontinued

Sign In for Pricing
View Details
ZNF91 Human shRNA Lentiviral Particle (Locus ID 7644)
TL308129V 500 µL Each

ZNF91 Human shRNA Lentiviral Particle (Locus ID 7644)

Sign In for Pricing
View Details
COMBI IC Reagent: Mouse anti CD45 (FITC) and Mouse anti CD14 (PE)
GCT-201 50 Tests

COMBI IC Reagent: Mouse anti CD45 (FITC) and Mouse anti CD14 (PE)

Sign In for Pricing
View Details