Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Adipoq protein

This Mouse Adipoq protein spans the amino acid sequence from region 18-247aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

30KDA adipocyte complement-related protein, Adipocyte complement-related 30KDA protein , ACRP30Adipocyte, C1q and collagen domain-containing protein, Adipocyte-specific protein AdipoQ

UniProt

Q60994

Expression Region

18-247aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Coagulation Factor II (F2)
TRV-0049340-01 20 µL

Polyclonal Antibody to Coagulation Factor II (F2)

Sign In for Pricing
View Details
Polyclonal Antibody to Coagulation Factor II (F2)
TRV-0049340-02 100 µL

Polyclonal Antibody to Coagulation Factor II (F2)

Sign In for Pricing
View Details
Polyclonal Antibody to Coagulation Factor II (F2)
TRV-0049340-03 200 µL

Polyclonal Antibody to Coagulation Factor II (F2)

Sign In for Pricing
View Details
Polyclonal Antibody to Coagulation Factor II (F2)
TRV-0049340-04 1 mL

Polyclonal Antibody to Coagulation Factor II (F2)

Sign In for Pricing
View Details
Mouse Monoclonal SARS RDRP Antibody (4E6) [PerCP]
NBP2-50258PCP 0.1 mL

Mouse Monoclonal SARS RDRP Antibody (4E6) [PerCP]

Sign In for Pricing
View Details
H-Ala-Ala-Glu-Oh
RM-A010100-01 10 mg

H-Ala-Ala-Glu-Oh

Sign In for Pricing
View Details