Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EIF3K protein

This Human EIF3K protein spans the amino acid sequence from region 2-218aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Eukaryotic translation initiation factor 3 subunit 12 Muscle-specific gene M9 protein PLAC-24 eIF-3 p25 eIF-3 p28 EIF3S12

UniProt

Q9UBQ5

Expression Region

2-218aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dehydro Venlafaxine
007892 1 mg

Dehydro Venlafaxine

Sign In for Pricing
View Details
UBA1 Antibody - N-terminal region
OAAB10873-400UL 400 µL

UBA1 Antibody - N-terminal region

Sign In for Pricing
View Details
FRMPD2 Peptide - N-terminal region
MBS3242407-01 0.1 mg

FRMPD2 Peptide - N-terminal region

Sign In for Pricing
View Details
FRMPD2 Peptide - N-terminal region
MBS3242407-02 5x 0.1 mg

FRMPD2 Peptide - N-terminal region

Sign In for Pricing
View Details
Zcchc13 (NM_029158) Mouse Recombinant Protein
TP521185 20 µg

Zcchc13 (NM_029158) Mouse Recombinant Protein

Sign In for Pricing
View Details
2-Ethyl-p-xylene
sc-485505 5 mL

2-Ethyl-p-xylene

Sign In for Pricing
View Details