Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EIF3K protein

This Human EIF3K protein spans the amino acid sequence from region 2-218aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Eukaryotic translation initiation factor 3 subunit 12 Muscle-specific gene M9 protein PLAC-24 eIF-3 p25 eIF-3 p28 EIF3S12

UniProt

Q9UBQ5

Expression Region

2-218aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TNFRSF9 aptamer
CTApt-2046 10 nmol

Anti-TNFRSF9 aptamer

Sign In for Pricing
View Details
KiSS-1 (112-121) amide / Kisspeptin-10 / Metastin (45-54) amide (Human)
048-56 200 µg

KiSS-1 (112-121) amide / Kisspeptin-10 / Metastin (45-54) amide (Human)

Sign In for Pricing
View Details
USP Sol. Sulfanilic Acid TS - 100ML
USP6001 100 mL

USP Sol. Sulfanilic Acid TS - 100ML

Sign In for Pricing
View Details
Rabbit anti-Drosophila pseudoobscura pseudoobscura (Fruit fly) hfw Polyclonal Antibody
MBS7149491 Inquire

Rabbit anti-Drosophila pseudoobscura pseudoobscura (Fruit fly) hfw Polyclonal Antibody

Sign In for Pricing
View Details
COCH Rabbit Polyclonal Antibody (FITC)
orb2098521 100 µL

COCH Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CYCSP23 AAV siRNA Pooled Vector
17263161 1.0 µg

CYCSP23 AAV siRNA Pooled Vector

Sign In for Pricing
View Details