Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EIF3K protein

This Human EIF3K protein spans the amino acid sequence from region 2-218aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Eukaryotic translation initiation factor 3 subunit 12 Muscle-specific gene M9 protein PLAC-24 eIF-3 p25 eIF-3 p28 EIF3S12

UniProt

Q9UBQ5

Expression Region

2-218aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENPP1 Human Over-expression Lysate
orb1359685 20 µg

ENPP1 Human Over-expression Lysate

Sign In for Pricing
View Details
VWC2L (NM_001080500) Human Over-expression Lysate
E45H05074-2 20 µg

VWC2L (NM_001080500) Human Over-expression Lysate

Sign In for Pricing
View Details
Inhibitor hsa-miR-6087 AAV miRNA Vector
Amh3204000 500 ng

Inhibitor hsa-miR-6087 AAV miRNA Vector

Sign In for Pricing
View Details
Recombinant Clostridium Botulinum CLK_2387 Protein (aa 1-228)
VAng-Lsx8098-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Botulinum CLK_2387 Protein (aa 1-228)

Sign In for Pricing
View Details
HPCAL4 Recombinant Protein (Rat)
RP205007 100 µg

HPCAL4 Recombinant Protein (Rat)

Sign In for Pricing
View Details
TNIK Antibody, Biotin conjugated
A37152-100UG 100 µg

TNIK Antibody, Biotin conjugated

Sign In for Pricing
View Details