Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse C1qtnf3 protein

This Mouse C1qtnf3 protein spans the amino acid sequence from region 23-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C1qtnf3; Cors26; Ctrp3; Complement C1q tumor necrosis factor-related protein 3; Collagenous repeat-containing sequence 26 kDa protein; CORS26; Secretory protein CORS26

UniProt

Q9ES30

Expression Region

23-246aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YFL021C-A Antibody
orb850629 2 mg

YFL021C-A Antibody

Sign In for Pricing
View Details
Anti-Human CD175s/STn Monoclonal Antibody (3F1), APC
PTX22876 100 µg

Anti-Human CD175s/STn Monoclonal Antibody (3F1), APC

Sign In for Pricing
View Details
Phospho GSK3beta (Ser9) Antibody (6H6)
MBS9525938-01 0.05 mL

Phospho GSK3beta (Ser9) Antibody (6H6)

Sign In for Pricing
View Details
Phospho GSK3beta (Ser9) Antibody (6H6)
MBS9525938-02 0.1 mL

Phospho GSK3beta (Ser9) Antibody (6H6)

Sign In for Pricing
View Details
Phospho GSK3beta (Ser9) Antibody (6H6)
MBS9525938-03 0.2 mL

Phospho GSK3beta (Ser9) Antibody (6H6)

Sign In for Pricing
View Details
Phospho GSK3beta (Ser9) Antibody (6H6)
MBS9525938-04 5x 0.2 mL

Phospho GSK3beta (Ser9) Antibody (6H6)

Sign In for Pricing
View Details