Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria isdA protein

This Bacteria isdA protein spans the amino acid sequence from region 47-316aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fur-regulated protein A Staphylococcal transferrin-binding protein A frpA, stbA

UniProt

Q6GA85

Expression Region

47-316aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain MSSA476)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATEATNATNNQSTQVSQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLADAAKPNNVKPVQPKPAQPKTPTEQTKPVQPKVEKVKPTVTTTSKVEDNHSTKVVSTDTTKDQTKTQTAHTVKTAQTAQEQNKVQTPVKDVATAKSESNNQAVSDNKSQQTNKVTKHNETPKQASKAKELPKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Chloro-cAMP sodium
orb2646183-01 25 mg

8-Chloro-cAMP sodium

Sign In for Pricing
View Details
8-Chloro-cAMP sodium
orb2646183-02 50 mg

8-Chloro-cAMP sodium

Sign In for Pricing
View Details
8-Chloro-cAMP sodium
orb2646183-03 100 mg

8-Chloro-cAMP sodium

Sign In for Pricing
View Details
Scrib ORF Vector (Rat) (pORF)
ORF075912 1.0 µg DNA

Scrib ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
mmu-miR-1936 miRNA Agomir
MBS8313899-01 5 nmol

mmu-miR-1936 miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-1936 miRNA Agomir
MBS8313899-02 10 nmol

mmu-miR-1936 miRNA Agomir

Sign In for Pricing
View Details